SMPD3 Polyclonal antibody 25613-1-AP proteintech
$149.00
In stock
SKU
25613-1-AP
| Catalog Number | 25613-1-AP |
| Synonyms | EC:3.1.4.12, Neutral sphingomyelinase 2, Neutral sphingomyelinase II, nSMase 2, nSMase2 |
| Host | Rabbit |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A549 cells, K-562 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Positive WB detected in | A549 cells, K-562 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag22487 Product name: Recombinant human SMPD3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 540-655 aa of BC112238 Sequence: PGEEKPWAIGTLLDTNGLYDEDVCTPDNLQKVLESEEGRREYLAFPTSKSSGQKGRKELLKGNGRRIDYMLHAEEGLCPDWKAEVEEFSFITQLSGLTDHLPVAMRLMVSSGEEEA Predict reactive species |
| Full Name | sphingomyelin phosphodiesterase 3, neutral membrane (neutral sphingomyelinase II) |
| Calculated Molecular Weight | 655 aa, 71 kDa |
| Observed Molecular Weight | 70-71 kDa |
| GenBank Accession Number | BC112238 |
| Gene Symbol | SMPD3 |
| Gene ID (NCBI) | 55512 |
| RRID | AB_3742154 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NY59 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for SMPD3 antibody 25613-1-AP | Download protocol |
| mouse | WB J Endocrinol ChREBP-β regulates thermogenesis in brown adipose tissue. Authors - Chunchun Wei View Article |
| Citations | 1 |
| Dilutions | WB : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
SMPD3 (sphingomyelin phosphodiesterase 3), also called neutral sphingomyelinase-2 (nSMase2), is a Golgi-enriched, membrane-bound Zn²⁺-dependent hydrolase that converts sphingomyelin into ceramide and phosphocholine. Ceramide functions as a bioactive lipid second messenger that integrates cellular stress, apoptosis, autophagy and differentiation signals. Protocols Product Specific Protocols WB protocol for SMPD3 antibody 25613-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- ChREBP-β regulates thermogenesis in brown adipose tissue.
Journal: J Endocrinol | Authors: Chunchun Wei | Species: mouse | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
