SSR3 Polyclonal antibody 30851-1-AP proteintech
$149.00
In stock
SKU
30851-1-AP
| Catalog Number | 30851-1-AP |
| Synonyms | SSR 3, SSR gamma, SSR-gamma, Translocon-associated protein subunit gamma, TRAP gamma |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, U-87 MG cells, mouse testis tissue, rat testis tissue |
| Tested Applications — Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive WB detected in | HeLa cells, U-87 MG cells, mouse testis tissue, rat testis tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, pig |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag28130 Product name: Recombinant human SSR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-140 aa of BC017203 Sequence: TYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFY Predict reactive species |
| Full Name | signal sequence receptor, gamma (translocon-associated protein gamma) |
| Calculated Molecular Weight | 185 aa, 21 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC017203 |
| Gene Symbol | SSR3 |
| Gene ID (NCBI) | 6747 |
| RRID | AB_3086422 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9UNL2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for SSR3 antibody 30851-1-AP | Download protocol |
| IHC protocol for SSR3 antibody 30851-1-AP | Download protocol |
| WB protocol for SSR3 antibody 30851-1-AP | Download protocol |
| human | WB Eur J Pharmacol Eeyarestatin I (ESI)-induced ERAD inhibition exhibits anti-cancer activity through multiple mechanisms in human colorectal cancer cells Authors - Jing Peng View Article |
| pig | WB J Virol The host protein SSR4 mediates PRRSV-induced endoplasmic reticulum stress via interaction with Nsp2. Authors - Yingchao Li View Article |
| Citations | 2 |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:50-1:500 IF-P : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Mammalian TRAP is a heterotetrameric membrane protein complex which comprised of four membrane proteins/subunits: alpha, beta, gamma, and delta. SSR3 is also known as translocon-associated protein subunit gamma (TRAPG). The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. SSR3 assumes a central position in the mammalian TRAP complex, binding to the ribosome on the cytosolic face of the ER membrane and coordinating the remaining TRAP subunits with the ribosome and the other translocon components. Protocols Product Specific Protocols IF protocol for SSR3 antibody 30851-1-AP Download protocol IHC protocol for SSR3 antibody 30851-1-AP Download protocol WB protocol for SSR3 antibody 30851-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Eeyarestatin I (ESI)-induced ERAD inhibition exhibits anti-cancer activity through multiple mechanisms in human colorectal cancer cells
Journal: Eur J Pharmacol | Authors: Jing Peng | Species: human | Application: WB - The host protein SSR4 mediates PRRSV-induced endoplasmic reticulum stress via interaction with Nsp2.
Journal: J Virol | Authors: Yingchao Li | Species: pig | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
