STK10 Polyclonal antibody 25471-1-AP proteintech
$149.00
In stock
SKU
25471-1-AP
| Catalog Number | 25471-1-AP |
| Synonyms | EC:2.7.11.1, LOK, Lymphocyte oriented kinase, Lymphocyte-oriented kinase, PRO2729 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | SKOV-3 cells, A549 cells, COLO 320 cells |
| Tested Applications — Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | SKOV-3 cells, A549 cells, COLO 320 cells |
| Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag22169 Product name: Recombinant human STK10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 369-519 aa of BC070077 Sequence: SQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDARIQVAQEKQVAEQGGDLSPAANRSQKASQSRPNSSALETLGGEKLANGSLEPPAQAAPGPSKRDSDCSSLCTSESMDYGTNLSTDLSLNKEMGSLSIKD Predict reactive species |
| Full Name | serine/threonine kinase 10 |
| Calculated Molecular Weight | 968 aa, 112 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | BC070077 |
| Gene Symbol | STK10 |
| Gene ID (NCBI) | 6793 |
| RRID | AB_2880096 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O94804 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for STK10 antibody 25471-1-AP | Download protocol |
| WB protocol for STK10 antibody 25471-1-AP | Download protocol |
| human | WB Cell Mol Biol Lett Phosphoproteomic profiling reveals post-translational dysregulation in Huntington's disease patient-derived neurons. Authors - Lea Danics View Article |
| Jared (Verified Customer) (08-21-2019) | This antibody is an all-star antibody. I can even re use it a couple of times, and it still works. potent stuff. Picture would not upload... There is one strong band, and it shows virtually nothing in the lane where I CRISPR'd out LOK aka STK10 in the LOK band area. There is a non-specific band, but that is located clearly out of the range of where the LOK band is located. Non-specific band at approx 200kd. LOK for me runs at around 140kd. Applications: Western Blot, Primary Antibody Dilution: 1:3000 Cell Tissue Type: 293T and H1299 STK10 Antibody Western Blot, validation (1:3000 dilution) in 293T and H1299 (Cat no:25471-1-AP) |
| Citations | 4 |
| Dilutions | WB : 1:500-1:1000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Lymphocyte-oriented kinase deficiency encoded by the serine/threonine kinase 10 (STK10) gene correlates with the intracellular adhesion molecule 1 (ICAM-1)/lymphocyte function associated antigen 1 (LFA-1) complex in aspirin hypersensitivity(PMID:21905501). STK 10 is also named as LOK and expressed as a 130-kDa protein, which was detected predominantly in lymphoid organs such as spleen, thymus, and bone marrow, in contrast to other mammalian members of the STE20 family(PMID:9278426). Protocols Product Specific Protocols IHC protocol for STK10 antibody 25471-1-AP Download protocol WB protocol for STK10 antibody 25471-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- The enhancement of immunoactivity induced by immunogenic cell death through serine/threonine kinase 10 inhibition: a potential therapeutic strategy
Journal: Front Immunol | Authors: Xiaoli Xia KD Validated | Species: human | Application: WB - Mechanism of ERK-mediated Rho Activation and Stress Fiber Assembly for Cell Migration.
Journal: bioRxiv | Authors: Akib M Khan KO Validated | Species: human | Application: WB - Combined CDK4/6 and ERK1/2 inhibition enhances anti-tumor activity in NF1-associated plexiform neurofibroma
Journal: Clin Cancer Res | Authors: Alyssa C Flint - Phosphoproteomic profiling reveals post-translational dysregulation in Huntington's disease patient-derived neurons.
Journal: Cell Mol Biol Lett | Authors: Lea Danics | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
