CoraLite® Plus 647-conjugated SUMO2/3 Monoclonal antibody CL647-67154 proteintech
$479.00
In stock
SKU
CL647-67154
| Catalog Number | CL647-67154 |
| Synonyms | SUMO2, Small ubiquitin-related modifier 2, Sentrin-2, Sentrin2, Sentrin 2 |
| Host | Mouse |
| Reactivity | Human, Mouse, Rat |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | FC (Intra) |
| Host / Isotype | Mouse / IgG2b |
| Tested Applications — Positive FC (Intra) detected in | K-562 cells |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| Positive FC (Intra) detected in | K-562 cells |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | Human, Mouse, Rat |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag28672 Product name: Recombinant human SUMO2/3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-95 aa of BC008450 Sequence: MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY Predict reactive species |
| Full Name | SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC008450 |
| Gene Symbol | SUMO2 |
| Gene ID (NCBI) | 6613 |
| RRID | AB_2935072 |
| Conjugate | CoraLite® Plus 647 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
| Excitation Laser | Red Laser (633 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | P61956 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| FC protocol for CL Plus 647 SUMO2/3 antibody CL647-67154 | Download protocol |
| Citations | - |
| Dilutions | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG2b |
| Clonality | Monoclonal |
| Clone Number | 1A1B3 |
| Conjugation | CoraLite® Plus 647 |
Ubiquitin is most famous for its function in targeting proteins for degradation by the 26S proteasome, ubiquitin needs to be attached to a substrate in chains (polyubiquitylation) before being recognized by proteasome. Similarly, SUMO (small ubiquitin-related modifier) can be linked to substrates in chains (polysumoylation), SUMO modification has been implicated in many important cellular processes including the control of genome stability, signal transduction, targeting to and formation of nuclear compartments, cell cycle and meiosis. There are 4 confirmed SUMO isoforms in human, SUMO-1, SUMO-2, SUMO-3 and SUMO-4. SUMO-2 and SUMO-3 are nearly identical but are distinct from SUMO-1. SUMO2/3 conjugation was recently widely involved in neuroprotective activities. A substitution (M55V) of SUMO4 was strongly associated with the pathogenesis of type 1 diabetes (T1D) involving NF kappa B related mechanisms. Protocols Product Specific Protocols FC protocol for CL Plus 647 SUMO2/3 antibody CL647-67154 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
