Synaptotagmin-1 Polyclonal antibody 14511-1-AP proteintech
$149.00
In stock
SKU
14511-1-AP
| Catalog Number | 14511-1-AP |
| Synonyms | Synaptotagmin 1, SYT1, P65, SVP65, synaptotagmin I |
| Host | Rabbit |
| Reactivity | human, mouse and More (1) |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse cerebellum tissue, HCT 116 cells, mouse testis tissue, human liver tissue, Y79 cells |
| Tested Applications — Positive IP detected in | mouse cerebellum tissue, HCT 116 cells |
| Tested Applications — Positive IHC detected in | rat small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells, HCT 116 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:4000-1:20000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | mouse cerebellum tissue, HCT 116 cells, mouse testis tissue, human liver tissue, Y79 cells |
| Positive IP detected in | mouse cerebellum tissue, HCT 116 cells |
| Positive IHC detected in | rat small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HCT 116 cells |
| Western Blot (WB) | WB : 1:4000-1:20000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag5970 Product name: Recombinant human SYT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-422 aa of BC058917 Sequence: GGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK Predict reactive species |
| Full Name | synaptotagmin I |
| Calculated Molecular Weight | 48 kDa |
| Observed Molecular Weight | 65 kDa, 47 kDa |
| GenBank Accession Number | BC058917 |
| Gene Symbol | Synaptotagmin-1 |
| Gene ID (NCBI) | 6857 |
| RRID | AB_2199166 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21579 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Synaptotagmin-1 antibody 14511-1-AP | Download protocol |
| IHC protocol for Synaptotagmin-1 antibody 14511-1-AP | Download protocol |
| IP protocol for Synaptotagmin-1 antibody 14511-1-AP | Download protocol |
| WB protocol for Synaptotagmin-1 antibody 14511-1-AP | Download protocol |
| human | WB Theranostics ANKRD22, a novel tumor microenvironment-induced mitochondrial protein promotes metabolic reprogramming of colorectal cancer cells. Authors - Tianhui Pan View Article |
| mouse | WB J Proteomics Quantitative proteomics reveals olfactory input-dependent alterations in the mouse olfactory bulb proteome. Authors - Hao-Long Zeng View Article |
| Citations | 34 |
| Dilutions | WB : 1:4000-1:20000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:500-1:2000 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). SYT1 (synaptotagmin I) was firstly identified as a 65-kDa protein with a wide distribution in neuronal and neurosecretory tissue (PMID: 7298720). Calcium binding to SYT1 participates in triggering neurotransmitter release at the synapse (PMID: 11242035). In addition to regulating exocytosis, SYT1 has also been implicated in endocytosis and neurite outgrowth (PMID: 15492212; 11078930; 10336114). This antibody recognizes endogenous SYT1, which has an experimentally determined molecular mass of 65-68 kDa. An additional band of 47 kDa could also be detected, which is corresponding to the calculated molecular weight of SYT1. Protocols Product Specific Protocols IF protocol for Synaptotagmin-1 antibody 14511-1-AP Download protocol IHC protocol for Synaptotagmin-1 antibody 14511-1-AP Download protocol IP protocol for Synaptotagmin-1 antibody 14511-1-AP Download protocol WB protocol for Synaptotagmin-1 antibody 14511-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- The complement inhibitor CD59 is required for GABAergic synaptic transmission in the dentate gyrus
Journal: Cell Rep | Authors: Lang Wen | Species: human | Application: WB - ANKRD22, a novel tumor microenvironment-induced mitochondrial protein promotes metabolic reprogramming of colorectal cancer cells.
Journal: Theranostics | Authors: Tianhui Pan | Species: human | Application: WB - A Stimulation Function of Synaptotagmin-1 in Ternary SNARE Complex Formation Dependent on Munc18 and Munc13.
Journal: Front Mol Neurosci | Authors: Yun Li - Early life stress enhances the susceptibility to depression and interferes with neuroplasticity in the hippocampus of adolescent mice via regulating miR-34c-5p/SYT1 axis
Journal: J Psychiatr Res | Authors: Shuwen Yu | Species: mouse | Application: WB,IHC - Hepatic Synaptotagmin 1 is involved in the remodelling of liver plasma- membrane lipid composition and gene expression in male Apoe-deficient mice consuming a Western diet.
Journal: Biochim Biophys Acta Mol Cell Biol Lipids | Authors: Sara Sancho-Knapik | Species: mouse | Application: WB,IHC - Quantitative proteomics reveals olfactory input-dependent alterations in the mouse olfactory bulb proteome.
Journal: J Proteomics | Authors: Hao-Long Zeng | Species: mouse | Application: WB - Gut-derived bacterial vesicles carrying lipopolysaccharide promote microglia-mediated synaptic pruning
Journal: Alzheimers Dement | Authors: Xiaoduo Zhao | Application: IF - PIAS1-mediated GSK3β SUMOylation exacerbates tauopathy and cognitive deficits in Alzheimer's disease models.
Journal: Mol Psychiatry | Authors: Youlan Qiu | Species: mouse | Application: WB,IP,IHC,IF - Analysis of microisolated frontal cortex excitatory layer III and V pyramidal neurons reveals a neurodegenerative phenotype in individuals with Down syndrome.
Journal: Acta Neuropathol | Authors: Melissa J. Alldred | Species: human | Application: WB - SP1 recruits TET1 to mediate Kif1a demethylation and synaptic remodeling in a mouse model of chronic migraine.
Journal: J Headache Pain | Authors: Wei Jiang | Species: mouse | Application: WB,IF - Hydrogen sulfide reduces oxidative stress in Huntington's disease via Nrf2
Journal: Neural Regen Res | Authors: Zige Jiang | Application: WB - The complement inhibitor CD59 is required for GABAergic synaptic transmission in the dentate gyrus
Journal: Cell Rep | Authors: Lang Wen | Species: human | Application: WB - Air pollution decreases postsynaptic PSD-95 and NMDA receptor subunits in synaptosomes from mouse cerebral cortex
Journal: Environ Pollut | Authors: Jose A Godoy-Lugo | Species: mouse | Application: WB - Buyang Huanwu Decoction improves synaptic plasticity of ischemic stroke by regulating the cAMP/PKA/CREB pathway
Journal: J Ethnopharmacol | Authors: Jingyuan Mo | Species: rat | Application: WB,IF - A Class I HDAC Inhibitor BG45 Alleviates Cognitive Impairment through the CaMKII/ITPKA/Ca2+ Signaling Pathway
Journal: Pharmaceuticals (Basel) | Authors: Jingyun Liu | Species: mouse | Application: IHC,IF - Opioids induce constipation by prompting alpha-Synuclein hyperphosphorylation in the colonic myenteric plexus
Journal: Neurochem Int | Authors: Binghan Jia - Synaptotagmin-1 antagonizes paraquat intracellular accumulation and nephrocyte toxicity by up-regulating SERBP1/GLUT2 expression
Journal: Chem Biol Interact | Authors: Ran Yin | Species: human | Application: WB - Tuina Inhibits Synaptic Plasticity Through the Astrocytic NDRG2/GLT-1 Pathway to Alleviate Neuropathic Pain.
Journal: J Cell Mol Med | Authors: Huanzhen Zhang | Species: rat | Application: WB - Evaluating the Efficacy of Levetiracetam on Non-Cognitive Symptoms and Pathology in a Tau Mouse Model
Journal: Biomedicines | Authors: Jackson C Thompson | Species: mouse | Application: WB - A Stimulation Function of Synaptotagmin-1 in Ternary SNARE Complex Formation Dependent on Munc18 and Munc13.
Journal: Front Mol Neurosci | Authors: Yun Li - Discrimination of the Activity of Low-Affinity Wild-Type and High-Affinity Mutant Recombinant BoNT/B by a SIMA Cell-Based Reporter Release Assay.
Journal: Toxins (Basel) | Authors: Frank Neuschäfer-Rube | Species: human | Application: WB - Hepatic Synaptotagmin 1 is involved in the remodelling of liver plasma- membrane lipid composition and gene expression in male Apoe-deficient mice consuming a Western diet.
Journal: Biochim Biophys Acta Mol Cell Biol Lipids | Authors: Sara Sancho-Knapik | Species: mouse | Application: WB,IHC - CBL proto-oncogene C-mediated synaptophysin 1 regulates prostate cancer progression in the TGF-beta signalling pathway.
Journal: Mol Immunol | Authors: Jianyong Tong | Species: human | Application: WB - Early life stress enhances the susceptibility to depression and interferes with neuroplasticity in the hippocampus of adolescent mice via regulating miR-34c-5p/SYT1 axis
Journal: J Psychiatr Res | Authors: Shuwen Yu | Species: mouse | Application: WB,IHC - Quantitative proteomics reveals olfactory input-dependent alterations in the mouse olfactory bulb proteome.
Journal: J Proteomics | Authors: Hao-Long Zeng | Species: mouse | Application: WB - The effects of hippocampal miR-34c-5p on the age-related discrepancies in susceptibility to traumatic stress in the post-traumatic stress disorder mice model.
Journal: Mol Pharmacol | Authors: Shuwen Yu | Species: mouse | Application: WB - Neuronal cell populations in circumoral nerve ring of sea cucumber Apostichopus japonicus: Ultrastructure and transcriptional profile
Journal: Comp Biochem Physiol Part D Genomics Proteomics | Authors: Yingqiu Zheng | Application: IF - Programmed cell death factor 4-mediated hippocampal synaptic plasticity is involved in early life stress and susceptibility to depression
Journal: Behav Brain Res | Authors: Jiao Cheng | Species: mouse | Application: WB - Identification of Protein Network Alterations upon Retinal Ischemia-Reperfusion Injury by Quantitative Proteomics Using a Rattus norvegicus Model.
Journal: PLoS One | Authors: Han Tian | Species: rat | Application: WB,IF - Cell type specific differences in transcriptome profiles of adipose derived stem cells and vaginal fibroblasts in patients with pelvic organ prolapse
Journal: Gene | Authors: Yourka D Tchoukalova - The expression profile of the SYT1 gene in laryngeal cancer and its influences on the biological behavior of laryngeal cancer cells.
Journal: Biochem Biophys Res Commun | Authors: Hengtao Zhu | Species: human | Application: WB,IHC - Quantitative proteomics study of host response to virulent and attenuated pseudorabies virus infection in mouse brain.
Journal: Biochim Biophys Acta | Authors: Hao-Long Zeng | Species: mouse | Application: WB - Long-read sequencing and profiling of RNA-binding proteins reveals the pathogenic mechanism of aberrant splicing of an SCN1A poison exon in epilepsy
Journal: bioRxiv | Authors: Hannah C Happ | Species: human | Application: WB - A guide to selecting high-performing antibodies for Synaptotagmin-1 (Uniprot ID P21579) for use in western blot, immunoprecipitation, immunofluorescence and flow cytometry
Journal: F1000Res | Authors: Michael S Biddle | Species: human | Application: WB,IP,IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
