TCTA Polyclonal antibody 15221-1-AP proteintech
$149.00
In stock
SKU
15221-1-AP
| Catalog Number | 15221-1-AP |
| Synonyms | TCTA |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HL-60 cells, K-562 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Positive WB detected in | HL-60 cells, K-562 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag7425 Product name: Recombinant human TCTA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC005157 Sequence: MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE Predict reactive species |
| Full Name | T-cell leukemia translocation altered gene |
| Calculated Molecular Weight | 11 kDa |
| GenBank Accession Number | BC005157 |
| Gene Symbol | TCTA |
| Gene ID (NCBI) | 6988 |
| RRID | AB_3085453 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P57738 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for TCTA antibody 15221-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
TCTA is required for cellular fusion during osteoclastogenesis. TCTA mRNA is expressed ubiquitously in normal tissues, with the highest levels of expression seen in the kidney. Protocols Product Specific Protocols WB protocol for TCTA antibody 15221-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
