TIMM8A Monoclonal antibody, PBS Only (Detector) 68866-4-PBS proteintech
$699.00
In stock
SKU
68866-4-PBS
| Catalog Number | 68866-4-PBS |
| Synonyms | TIM8A, DDP, DDP1, DFN1, MTS |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag33190 Product name: Recombinant human TIMM8A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-97 aa of BC015093 Sequence: MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD Predict reactive species |
| Full Name | translocase of inner mitochondrial membrane 8 homolog A (yeast) |
| Calculated Molecular Weight | 11 kDa |
| GenBank Accession Number | BC015093 |
| Gene Symbol | TIMM8A |
| Gene ID (NCBI) | 1678 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | O60220 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 3B8E5 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
