TMEM119 Polyclonal antibody 27585-1-AP proteintech
$149.00
In stock
SKU
27585-1-AP
| Catalog Number | 27585-1-AP |
| Synonyms | OBIF, Osteoblast induction factor, transmembrane protein 119, UNQ731/PRO1415 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, FC (Intra), ELISA |
| Applications | IHC, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive FC (Intra) detected in | HEK-293 cells |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HEK-293 cells |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag26269 Product name: Recombinant human TMEM119 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-218 aa of NM_181724 Sequence: MRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQE Predict reactive species |
| Full Name | transmembrane protein 119 |
| Calculated Molecular Weight | 29 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | NM_181724 |
| Gene Symbol | TMEM119 |
| Gene ID (NCBI) | 338773 |
| RRID | AB_2880915 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q4V9L6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for TMEM119 antibody 27585-1-AP | Download protocol |
| IHC protocol for TMEM119 antibody 27585-1-AP | Download protocol |
| human | Neurochem Res BMP7 Attenuates Neuroinflammation after Spinal Cord Injury by Suppressing the Microglia Activation and Inducing Microglial Polarization Via the STAT3 Pathway Authors - Xiaojin Wei View Article |
| mouse,human | Nat Commun P-selectin axis plays a key role in microglia immunophenotype and glioblastoma progression. Authors - Eilam Yeini View Article |
| mouse | IF Front Immunol Didymin Suppresses Microglia Pyroptosis and Neuroinflammation Through the Asc/Caspase-1/GSDMD Pathway Following Experimental Intracerebral Hemorrhage. Authors - Lingui Gu View Article |
| Marion (Verified Customer) (07-15-2025) | Immunohistofluorescence (PFA-fixed cryosections) image of TMEM119 stained murine brain. Blocking step : 10 % Donkey Serum + 1% BSA + 0.02% Triton as blocking agent for 2 hours at RT Primary antiboby incubation time : 1 night / 4°C Secondary antibody : AlexaFluor 568 (ab175470 ; Abcam) ; 1/200 This antibody does not seem to work under these conditions. Applications: Immunofluorescence Primary Antibody Dilution: 1/200 (Also tested at 1/100; 1/400; 1/600 and 1/800) Cell Tissue Type: Mouse Brain TMEM119 Antibody Immunofluorescence validation (1/200 (Also tested at 1/100; 1/400; 1/600 and 1/800) dilution) in Mouse Brain (Cat no:27585-1-AP) |
| Hannes (Verified Customer) (07-27-2020) | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)IHC-P image of anti-TMEM119 (27585-1-AP) stained murine and human brain. The tissue was paraffin-embedded, formalin fixed. The tissue was then incubated with EnVision+ Single Reagents (HRP. Rabbit), undiluted for 1 hour at room temperature. Applications: Immunohistochemistry Primary Antibody Dilution: 1:500 Cell Tissue Type: Murine and human brain tissue TMEM119 Antibody Immunohistochemistry validation (1:500 dilution) in Murine and human brain tissue (Cat no:27585-1-AP) |
| Citations | 32 |
| Dilutions | IHC : 1:250-1:1000 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Microglia can be detected clearly using Catalog#27585-1-AP. Protocols Product Specific Protocols FC protocol for TMEM119 antibody 27585-1-AP Download protocol IHC protocol for TMEM119 antibody 27585-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Single-cell analysis of human basal cell carcinoma reveals novel regulators of tumor growth and the tumor microenvironment.
Journal: Sci Adv | Authors: Christian F Guerrero-Juarez | Species: human | Application: IHC - P-selectin axis plays a key role in microglia immunophenotype and glioblastoma progression.
Journal: Nat Commun | Authors: Eilam Yeini | Species: mouse,human - Transmembrane protein 119 is neither a specific nor a reliable marker for microglia.
Journal: Glia | Authors: Elise Vankriekelsvenne | Species: human | Application: IF - MSCs-extracellular vesicles attenuated neuroinflammation, synapse damage and microglial phagocytosis after hypoxia-ischemia injury by preventing osteopontin expression.
Journal: Pharmacol Res | Authors: Danqing Xin | Species: mouse | Application: IF - Didymin Suppresses Microglia Pyroptosis and Neuroinflammation Through the Asc/Caspase-1/GSDMD Pathway Following Experimental Intracerebral Hemorrhage.
Journal: Front Immunol | Authors: Lingui Gu | Species: mouse | Application: IF - BMP7 Attenuates Neuroinflammation after Spinal Cord Injury by Suppressing the Microglia Activation and Inducing Microglial Polarization Via the STAT3 Pathway
Journal: Neurochem Res | Authors: Xiaojin Wei | Species: human - GSDME-mediated pyroptosis in microglia exacerbates demyelination and neuroinflammation in multiple sclerosis: insights from humans and cuprizone-induced demyelination model mice
Journal: Cell Death Differ | Authors: Danjie Wang - MSCs-extracellular vesicles attenuated neuroinflammation, synapse damage and microglial phagocytosis after hypoxia-ischemia injury by preventing osteopontin expression.
Journal: Pharmacol Res | Authors: Danqing Xin | Species: mouse | Application: IF - NLRC5 restricts Japanese encephalitis virus replication and neuroinflammation by interacting with the viral NS3 protein in an IFN-γ-dependent manner.
Journal: J Neuroinflammation | Authors: Prasanjit Jena - Hyperphosphorylated tau mediates neuronal death by inducing necroptosis and inflammation in Alzheimer's disease
Journal: J Neuroinflammation | Authors: Yue Dong | Species: human | Application: WB - miR-223 accelerates lipid droplets clearance in microglia following spinal cord injury by upregulating ABCA1
Journal: J Transl Med | Authors: Zhilin Ou | Species: mouse | Application: IF - The DRP1 inhibitory peptide P110 provides neuroprotection after subarachnoid hemorrhage by suppressing neuronal apoptosis and stabilizing the blood-brain barrier.
Journal: Free Radic Biol Med | Authors: Shuangying Hao | Species: mouse | Application: WB,IHC,IF - CXCL1-CXCR2 signaling mediates the activation of microglia in the nucleus tractus solitarii to promote pancreatic cancer-induced pain
Journal: Brain Behav Immun | Authors: Kang Chen | Species: mouse | Application: WB - Didymin Suppresses Microglia Pyroptosis and Neuroinflammation Through the Asc/Caspase-1/GSDMD Pathway Following Experimental Intracerebral Hemorrhage.
Journal: Front Immunol | Authors: Lingui Gu | Species: mouse | Application: IF - Tetramerization of PKM2 Alleviates Traumatic Brain Injury by Ameliorating Mitochondrial Damage in Microglia
Journal: J Neuroimmune Pharmacol | Authors: Haiyan Zhu | Species: mouse | Application: IF - Expression of anti-amyloid CARs in microglia promotes efficient and selective phagocytosis of Aβ1‒42
Journal: Gene Ther | Authors: Christina N Heiss | Species: human | Application: IF - Integrative analysis of single-cell and bulk transcriptome data reveals age-related immune cell alterations in primary glioblastoma associated with prognosis.
Journal: Cancer Immunol Immunother | Authors: Zefan Jing | Species: mouse | Application: IF - Extracellular Vesicle-Liposome-Darunavir Formulation for the Treatment of HIV Neuropathogenesis
Journal: ACS Appl Nano Mater | Authors: Lina Zhou | Application: WB - Esketamine improves cognitive function in sepsis-associated encephalopathy by inhibiting microglia-mediated neuroinflammation
Journal: Eur J Pharmacol | Authors: Hui Li | Species: mouse | Application: WB - Transmembrane protein 119 is neither a specific nor a reliable marker for microglia.
Journal: Glia | Authors: Elise Vankriekelsvenne | Species: human | Application: IF - Changes in the microglial phenotype drive neuroinflammation independent of systemic inflammation in the acute stage of heatstroke.
Journal: iScience | Authors: Ping Li | Species: mouse | Application: IF - BMP7 Attenuates Neuroinflammation after Spinal Cord Injury by Suppressing the Microglia Activation and Inducing Microglial Polarization Via the STAT3 Pathway
Journal: Neurochem Res | Authors: Xiaojin Wei | Species: human - Validation of Induced Microglia-Like Cells (iMG Cells) for Future Studies of Brain Diseases.
Journal: Front Cell Neurosci | Authors: Atoshi Banerjee | Species: human | Application: IHC - Deacetylase SIRT2 Inhibition Promotes Microglial M2 Polarization Through Axl/PI3K/AKT to Alleviate White Matter Injury After Subarachnoid Hemorrhage
Journal: Transl Stroke Res | Authors: Kaikun Yuan - Attenuation of Blood-Brain Barrier Disruption in Traumatic Brain Injury via Inhibition of NKCC1 Cotransporter: Insights into the NF-κB/NLRP3 Signaling Pathway
Journal: J Neurotrauma | Authors: Zehan Zhang | Species: mouse | Application: IF - Toll-like receptor-9 (TLR-9) deficiency alleviates optic nerve injury (ONI) by inhibiting inflammatory response in vivo and in vitro.
Journal: Exp Cell Res | Authors: Lu Zhang | Species: mouse | Application: WB,IF - TMEM119 links to ovarian endometriosis progression via MAPK-mediated suppression of ectopic endometrial stromal cell senescence.
Journal: Reproduction | Authors: Liansuo Zhang | Species: human | Application: WB,IHC - Early Histone Deacetylase Inhibition Mitigates Ischemia/Reperfusion Brain Injury by Reducing Microglia Activation and Modulating Their Phenotype.
Journal: Front Neurol | Authors: Shuyuan Li | Species: mouse | Application: IF - IL-6 mediates olfactory dysfunction in a mouse model of allergic rhinitis
Journal: Brain Res | Authors: Xiao-Yu Song | Species: mouse | Application: IF - A modified high-yield method for primary culture of rat retinal microglial cells.
Journal: Exp Eye Res | Authors: Xiaokun Han | Application: IF - Protocol for differentiation and efficient AAV-mediated gene delivery to hiPSC-derived microglia for functional studies.
Journal: STAR Protoc | Authors: Christina N. Heiss | Species: human | Application: IF - Programs, Origins, and Niches of Immunomodulatory Myeloid Cells in Gliomas
Journal: bioRxiv | Authors: Tyler E Miller | Species: human | Application: IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
