TMEM138 Polyclonal antibody 26642-1-AP proteintech
$149.00
In stock
SKU
26642-1-AP
| Catalog Number | 26642-1-AP |
| Synonyms | HSPC196, HSPC198, JBTS16, transmembrane protein 138 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IF/ICC detected in | hTERT-RPE1 cells |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive IF/ICC detected in | hTERT-RPE1 cells |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag24487 Product name: Recombinant human TMEM138 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 101-162 aa of BC005201 Sequence: NLRWKNSNSFIWTDGLQMLFVFQRLAAVLYCYFYKRTAVRLGDPHFYQDSLWLRKEFMQVRR Predict reactive species |
| Full Name | transmembrane protein 138 |
| Calculated Molecular Weight | 162 aa, 19 kDa |
| GenBank Accession Number | BC005201 |
| Gene Symbol | TMEM138 |
| Gene ID (NCBI) | 51524 |
| RRID | AB_3742197 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NPI0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for TMEM138 antibody 26642-1-AP | Download protocol |
| Citations | - |
| Dilutions | IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
The TMEM138 gene encodes a protein with multiple transmembrane domains that is expressed in various tissues and involved in regulating biological processes. While its exact cellular localization and function are not fully understood, studies suggest it may impact neural development and disease occurrence by influencing intracellular signal transduction pathways, cytoskeleton dynamics, and membrane protein transport mechanisms. Tmem138 and Tmem216 are arranged in a head-to-tail configuration on human chromosome 11 and mouse chromosome 19, sharing intergenic regulatory elements . Tmem138 is localized at the ciliary base and axoneme, while Tmem216 is primarily in the BBs in IMCD3 cells . (PMID: 35394880,PMID: 40432436) Protocols Product Specific Protocols IF protocol for TMEM138 antibody 26642-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
