TNFSF13 Recombinant monoclonal antibody, PBS Only (Capture) 86766-2-PBS proteintech
$699.00
In stock
SKU
86766-2-PBS
| Catalog Number | 86766-2-PBS |
| Synonyms | A proliferation-inducing ligand, APRIL, CD256, TALL2, TALL-2 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg3664 Product name: Recombinant Human TNFSF13/APRIL protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 105-250 aa of NM_003808.3 Sequence: AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL Predict reactive species |
| Full Name | tumor necrosis factor (ligand) superfamily, member 13 |
| Calculated Molecular Weight | 27 kDa |
| GenBank Accession Number | NM_003808.3 |
| Gene Symbol | TNFSF13 |
| Gene ID (NCBI) | 8741 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O75888-1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250527E5 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
