TRIM26 Recombinant monoclonal antibody 84661-4-RR proteintech
$149.00
In stock
SKU
84661-4-RR
| Catalog Number | 84661-4-RR |
| Synonyms | 242154B5, EC:2.3.2.27, RNF95, TRIM, Tripartite motif-containing protein 26 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, HEK-293T cells |
| Tested Applications — Positive IHC detected in | human rectal cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, HEK-293T cells |
| Positive IHC detected in | human rectal cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag25546 Product name: Recombinant human TRIM26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-270 aa of BC024039 Sequence: NHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQDTRDFLNRYPRKKFW Predict reactive species |
| Full Name | tripartite motif-containing 26 |
| Calculated Molecular Weight | 62 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC024039 |
| Gene Symbol | TRIM26 |
| Gene ID (NCBI) | 7726 |
| RRID | AB_3743639 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q12899 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for TRIM26 antibody 84661-4-RR | Download protocol |
| WB protocol for TRIM26 antibody 84661-4-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242154B5 |
| Conjugation | Unconjugated |
TRIM26 is a member of the tripartite motif (TRIM) protein family composed of more than 70 members in human. TRIM proteins share a similar characteristic structure, which includes a RING (R) domain, one or two B-boxes (B), and a coiled coil (CC) domain in the N-terminal and a domain in the C-terminal with variable structures. TRIM26 potentiates virus-triggered IRF3, NF-κB activation, IFN-β induction, and cellular antiviral responses. Further investigation suggests that TRIM26 plays an important role in the antiviral innate immune response by bridging TBK1 to NEMO and mediating TBK1 activation. (PMID: 25763818, PMID: 26611359) Protocols Product Specific Protocols IHC protocol for TRIM26 antibody 84661-4-RR Download protocol WB protocol for TRIM26 antibody 84661-4-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
