TRIM36 Monoclonal antibody, PBS Only (Detector) 60653-5-PBS proteintech
$699.00
In stock
SKU
60653-5-PBS
| Catalog Number | 60653-5-PBS |
| Synonyms | E3 ubiquitin-protein ligase TRIM36, EC:2.3.2.27, RING-type E3 ubiquitin transferase TRIM36, RNF98, tripartite motif containing 36 |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Mouse / IgG3 |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag23227 Product name: Recombinant human TRIM36 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 166-215 aa of BC130334 Sequence: ESTKSCMDCSASYCNECFKIHHPWGTIKAQHEYVGPTTNFRPKILMCPEH Predict reactive species |
| Full Name | tripartite motif-containing 36 |
| GenBank Accession Number | BC130334 |
| Gene Symbol | TRIM36 |
| Gene ID (NCBI) | 55521 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NQ86 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG3 |
| Clonality | Monoclonal |
| Clone Number | 2F8B6 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
