TSH Beta Polyclonal antibody 27288-1-AP proteintech
$149.00
In stock
SKU
27288-1-AP
| Catalog Number | 27288-1-AP |
| Synonyms | CHNG4, Thyrotropin alfa, Thyrotropin beta chain, Thyrotropin subunit beta, TSH B, TSH BETA, TSHB |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | human pituitary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive IHC detected in | human pituitary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag25532 Product name: Recombinant human TSHB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-138 aa of BC069298 Sequence: YALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV Predict reactive species |
| Full Name | thyroid stimulating hormone, beta |
| Calculated Molecular Weight | 138 aa, 16 kDa |
| GenBank Accession Number | BC069298 |
| Gene Symbol | TSH beta |
| Gene ID (NCBI) | 7252 |
| RRID | AB_2880831 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01222 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for TSH Beta antibody 27288-1-AP | Download protocol |
| Citations | - |
| Dilutions | IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
