TSPAN33 Polyclonal antibody 14329-1-AP proteintech
$149.00
In stock
SKU
14329-1-AP
| Catalog Number | 14329-1-AP |
| Synonyms | hPen, PEN, Penumbra, Proerythroblast new membrane, tetraspanin 33, Tspan 33, TSPAN33 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | human brain tissue, human plasma tissue |
| Tested Applications — Positive IHC detected in | human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:200-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Positive WB detected in | human brain tissue, human plasma tissue |
| Positive IHC detected in | human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag5597 Product name: Recombinant human TSPAN33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 116-236 aa of BC044244 Sequence: FVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNL Predict reactive species |
| Full Name | tetraspanin 33 |
| Calculated Molecular Weight | 32 kDa |
| Observed Molecular Weight | 64-72 kDa |
| GenBank Accession Number | BC044244 |
| Gene Symbol | TSPAN33 |
| Gene ID (NCBI) | 340348 |
| RRID | AB_10644331 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86UF1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for TSPAN33 antibody 14329-1-AP | Download protocol |
| WB protocol for TSPAN33 antibody 14329-1-AP | Download protocol |
| mouse | WB J Immunol The Tetraspanin TSPAN33 Controls TLR-Triggered Macrophage Activation through Modulation of NOTCH Signaling. Authors - Almudena Ruiz-García View Article |
| Citations | 1 |
| Dilutions | WB : 1:200-1:1000 IHC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
TSPAN33 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN33 belongs to the TSPANC8 subfamily, which also include TSPAN5, TSPAN10, TSPAN14, TSPAN15, and TSPAN17. It has been reported that TSPANC8 tetraspanins interact with ADAM10 and have a conserved function in the regulation of ADAM10 trafficking and activity, thereby positively regulating Notch receptor activation (PMID: 23091066; 23035126). Protocols Product Specific Protocols IHC protocol for TSPAN33 antibody 14329-1-AP Download protocol WB protocol for TSPAN33 antibody 14329-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- The Tetraspanin TSPAN33 Controls TLR-Triggered Macrophage Activation through Modulation of NOTCH Signaling.
Journal: J Immunol | Authors: Almudena Ruiz-García | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
