Mouse Tnfsf18 Recombinant monoclonal antibody, PBS Only (Detector) 85842-2-PBS proteintech
$699.00
In stock
SKU
85842-2-PBS
| Catalog Number | 85842-2-PBS |
| Synonyms | GITR ligand, GITRL, Glucocorticoid-induced TNF-related ligand, Tumor necrosis factor ligand superfamily member 18 |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2850 Product name: Recombinant Mouse TNFSF18 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 47-173 aa of NM_183391.3 Sequence: TAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS Predict reactive species |
| Full Name | tumor necrosis factor (ligand) superfamily, member 18 |
| Calculated Molecular Weight | 20 kDa |
| GenBank Accession Number | NM_183391.3 |
| Gene Symbol | Tnfsf18 |
| Gene ID (NCBI) | 240873 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q7TS55 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242937H3 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
