CoraLite® Plus 488-conjugated Transgelin 2 Monoclonal antibody CL488-60044 proteintech
$479.00
In stock
SKU
CL488-60044
| Catalog Number | CL488-60044 |
| Synonyms | TAGLN2, Transgelin 2/TAGLN2, SM22-alpha homolog, Epididymis tissue protein Li 7e, CDABP0035 |
| Host | Mouse |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF/ICC, IF-P |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive IF-P detected in | human colon cancer tissue |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive IF-P detected in | human colon cancer tissue |
| Positive IF/ICC detected in | HepG2 cells |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag0337 Product name: Recombinant human TAGLN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-130 aa of BC002616 Sequence: RGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINAQYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLM Predict reactive species |
| Full Name | transgelin 2 |
| Calculated Molecular Weight | 199 aa, 22 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC002616 |
| Gene Symbol | Transgelin-2/TAGLN2 |
| Gene ID (NCBI) | 8407 |
| RRID | AB_3084132 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Protein G purification |
| UNIPROT ID | P37802 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| IF protocol for CL Plus 488 Transgelin 2 antibody CL488-60044 | Download protocol |
| Citations | - |
| Dilutions | IF-P : 1:50-1:500 IF/ICC : 1:50-1:500 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 2E5G1 |
| Conjugation | CoraLite® Plus 488 |
The transgelin family is a group of proteins that belong to 22 kDa actin-related corpnin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22 alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells. Our test result showed that this antibody Is specific to TAGLN2. It does not bind TAGLN1 and TAGLN3. Protocols Product Specific Protocols IF protocol for CL Plus 488 Transgelin 2 antibody CL488-60044 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
