VEGF-C Recombinant monoclonal antibody, PBS Only 83727-1-PBS proteintech
$699.00
In stock
SKU
83727-1-PBS
| Catalog Number | 83727-1-PBS |
| Synonyms | VEGFC, vascular endothelial growth factor C, Vascular endothelial growth factor-related protein, VEGF C |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg32025 Product name: Recombinant Human VEGFC protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 103-227 aa of BC035212 Sequence: TEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR Predict reactive species |
| Full Name | vascular endothelial growth factor C |
| Calculated Molecular Weight | 419 aa, 47 kDa |
| GenBank Accession Number | BC035212 |
| Gene Symbol | VEGFC |
| Gene ID (NCBI) | 7424 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P49767 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240772A5 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
