VPS18 Monoclonal antibody 67590-1-Ig proteintech
$149.00
In stock
SKU
67590-1-Ig
| Catalog Number | 67590-1-Ig |
| Synonyms | hVPS18, KIAA1475, PEP3, VPS18 |
| Host | Mouse |
| Reactivity | Human, Rat |
| Reactivity | human, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG2a |
| Tested Applications — Positive WB detected in | A549 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells |
| Tested Applications — Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | A549 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | A549 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | Human, Rat |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag29954 Product name: Recombinant human VPS18 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 226-355 aa of BC001513 Sequence: QRLFQFIGRAAEGAEAQGFSGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGALDCGRPDSLLSEERVWEYPEGVGPGASPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVL Predict reactive species |
| Full Name | vacuolar protein sorting 18 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 110 kDa |
| Observed Molecular Weight | 100-110 kDa |
| GenBank Accession Number | BC001513 |
| Gene Symbol | VPS18 |
| Gene ID (NCBI) | 57617 |
| RRID | AB_2882798 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9P253 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for VPS18 antibody 67590-1-Ig | Download protocol |
| IHC protocol for VPS18 antibody 67590-1-Ig | Download protocol |
| WB protocol for VPS18 antibody 67590-1-Ig | Download protocol |
| Citations | - |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:500-1:2000 IF/ICC : 1:50-1:500 |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Clone Number | 2E10G11 |
| Conjugation | Unconjugated |
Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Vps18 is a central member of Vps-C complex. Vps18 may play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes. Protocols Product Specific Protocols IF protocol for VPS18 antibody 67590-1-Ig Download protocol IHC protocol for VPS18 antibody 67590-1-Ig Download protocol WB protocol for VPS18 antibody 67590-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
