WEE1 Polyclonal antibody 29474-1-AP proteintech
$149.00
In stock
SKU
29474-1-AP
| Catalog Number | 29474-1-AP |
| Synonyms | DKFZp686I18166, FLJ16446, WEE1, WEE1 homolog (S. pombe), Wee1 like protein kinase, WEE1A, Wee1A kinase, WEE1hu |
| Host | Rabbit |
| Reactivity | Human, mouse and More (2) |
| Reactivity | human, mouse, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF, CoIP, ELISA |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | K-562 cells, nouse brain tissue, mouse heart tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Positive WB detected in | K-562 cells, nouse brain tissue, mouse heart tissue |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Tested Reactivity | Human, mouse |
| Cited Reactivity | human, mouse, pig |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag30194 Product name: Recombinant human WEE1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 515-646 aa of BC051831 Sequence: PLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY Predict reactive species |
| Full Name | WEE1 homolog (S. pombe) |
| Calculated Molecular Weight | 72 kDa |
| Observed Molecular Weight | 72 kDa,110 kDa |
| GenBank Accession Number | BC051831 |
| Gene Symbol | WEE1 |
| Gene ID (NCBI) | 7465 |
| RRID | AB_2918314 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P30291 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for WEE1 antibody 29474-1-AP | Download protocol |
| mouse | WB Ren Fail Hyperactivation of p53 contributes to mitotic catastrophe in podocytes through regulation of the Wee1/CDK1/cyclin B1 axis Authors - Jie Feng View Article |
| pig | WB Cells Role of Alternative Splicing and Polyadenylation in Regulation of Spleen Development. Authors - Jinghao Cui View Article |
| human | WB Oncol Res SORBS1 Knockdown Resists S/G2 Arrest and Apoptosis Caused by Polyphyllin H-Induced DNA Damage in Pancreatic Cancer Authors - Xinxin Hu View Article |
| Citations | 10 |
| Dilutions | WB : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
WEE1 kinase is a serine-threonine kinase that regulates G2/M checkpoint transition. WEE1 triggers G2/M arrest through inhibitory phosphorylation on Tyr15 of CDK1 (Cdc2) and preventing entry into mitosis to allow DNA repair during DNA damage (PMID: 27427153).The predicted native molecular weight for Wee1 based on the intact human Wee1 cDNA sequence is 72 kDa, whereas the 95-110 kDa protein is a highly modified product (PMID: 7568188). Others have shown that Wee1 is 70-72 kDa and 49-55 kDa (PMID: 12214061). Protocols Product Specific Protocols WB protocol for WEE1 antibody 29474-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- DIS3L2 ribonuclease degrades terminal-uridylated RNA to ensure oocyte maturation and female fertility
Journal: Nucleic Acids Res | Authors: Di Wu | Species: mouse | Application: IF - Malate targets pyruvate kinase M2 to promote colorectal cancer cell cycle arrest and tumor suppression.
Journal: Mol Biomed | Authors: Kun Zhao | Species: mouse | Application: WB - Role of Alternative Splicing and Polyadenylation in Regulation of Spleen Development.
Journal: Cells | Authors: Jinghao Cui | Species: pig | Application: WB - Venetoclax enhances DNA damage induced by XPO1 inhibitors: A novel mechanism underlying the synergistic antileukaemic effect in acute myeloid leukaemia.
Journal: J Cell Mol Med | Authors: Hanxi Yu | Species: human | Application: WB - SORBS1 Knockdown Resists S/G2 Arrest and Apoptosis Caused by Polyphyllin H-Induced DNA Damage in Pancreatic Cancer
Journal: Oncol Res | Authors: Xinxin Hu | Species: human | Application: WB - Hyperactivation of p53 contributes to mitotic catastrophe in podocytes through regulation of the Wee1/CDK1/cyclin B1 axis
Journal: Ren Fail | Authors: Jie Feng | Species: mouse | Application: WB - GL-V9 synergizes with oxaliplatin of colorectal cancer via Wee1 degradation mediated by HSP90 inhibition
Journal: J Pharm Pharmacol | Authors: Hongyu Chen | Species: human,mouse | Application: WB,CoIP - High-dose zearalenone exposure disturbs G2/M transition during mouse oocyte maturation.
Journal: Reprod Toxicol | Authors: Yi-Ming Ji | Species: mouse | Application: WB - miR-138-5p Inhibits the Growth and Invasion of Glioma Cells by Regulating WEE1.
Journal: Anal Cell Pathol (Amst) | Authors: Jianwu Gong | Species: human | Application: WB - TET2 aggravates podocyte mitotic catastrophe and renal injury in diabetic nephropathy via m5C-dependent downregulation of Wee1 and activation of CDK1-cyclinB1 signaling.
Journal: Inflamm Res | Authors: Jie Feng
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
