WNT2 Polyclonal antibody 27214-1-AP proteintech
$149.00
In stock
SKU
27214-1-AP
| Catalog Number | 27214-1-AP |
| Synonyms | Int 1 like protein 1, Int 1 related protein, INT1L1, Int-1-like protein 1, Int-1-related protein |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue, rat brain tissue, MCF-7 cells |
| Tested Applications — Positive IHC detected in | rat brain tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | MCF-7 cells |
| Tested Applications — Positive FC (Intra) detected in | Jurkat cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | mouse brain tissue, rat brain tissue, MCF-7 cells |
| Positive IHC detected in | rat brain tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
| Positive FC (Intra) detected in | Jurkat cells |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag25845 Product name: Recombinant human WNT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 231-270 aa of BC029854 Sequence: GDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVY Predict reactive species |
| Full Name | wingless-type MMTV integration site family member 2 |
| Calculated Molecular Weight | 40 kDa |
| Observed Molecular Weight | 34-40 kDa |
| GenBank Accession Number | BC029854 |
| Gene Symbol | WNT2 |
| Gene ID (NCBI) | 7472 |
| RRID | AB_2880804 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P09544 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for WNT2 antibody 27214-1-AP | Download protocol |
| IF protocol for WNT2 antibody 27214-1-AP | Download protocol |
| IHC protocol for WNT2 antibody 27214-1-AP | Download protocol |
| WB protocol for WNT2 antibody 27214-1-AP | Download protocol |
| mouse | WB Brain Res Bull Excess folic acid supplementation before and during pregnancy and lactation activates β-catenin in the brain of male mouse offspring. Authors - Qian Wu View Article |
| human | WB Cancer Med Mycoplasma hyorhinis infection promotes gastric cancer cell motility via β-catenin signaling. Authors - Xia Liu KD Validated View Article |
| Citations | 17 |
| Dilutions | WB : 1:500-1:1000 IHC : 1:50-1:500 IF/ICC : 1:50-1:500 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Wnt2 is a secreted glycoprotein that is one of the canonical Wnt ligands. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Wnt2 is known to directly regulate β-catenin activity, the key player in proliferation and inflammation. Recently, studies have demonstrated that Wnt2 is overexpressed in various human cancers, including esophageal, gastric, colorectal, breast, lung, cervical, and malignant glioma. Protocols Product Specific Protocols FC protocol for WNT2 antibody 27214-1-AP Download protocol IF protocol for WNT2 antibody 27214-1-AP Download protocol IHC protocol for WNT2 antibody 27214-1-AP Download protocol WB protocol for WNT2 antibody 27214-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Ursodesoxycholic acid alleviates liver fibrosis via proregeneration by activation of the ID1-WNT2/HGF signaling pathway.
Journal: Clin Transl Med | Authors: Xi Dong | Species: mouse | Application: WB - LncRNA-HAGLR motivates triple negative breast cancer progression by regulation of WNT2 via sponging miR-335-3p.
Journal: Aging (Albany NY) | Authors: Liting Jin | Species: human | Application: WB - Bisphenol A exposure alters placentation and causes preeclampsia-like features in pregnant mice involved in reprogramming of DNA methylation of WNT2.
Journal: FASEB J | Authors: Yunzhen Ye | Species: mouse | Application: WB - Capsaicin suppressed activity of prostate cancer stem cells by inhibition of Wnt/β-catenin pathway.
Journal: Phytother Res | Authors: Mingming Zhu | Species: human | Application: WB - Excess folic acid supplementation before and during pregnancy and lactation activates β-catenin in the brain of male mouse offspring.
Journal: Brain Res Bull | Authors: Qian Wu | Species: mouse | Application: WB - Mycoplasma hyorhinis infection promotes gastric cancer cell motility via β-catenin signaling.
Journal: Cancer Med | Authors: Xia Liu KD Validated | Species: human | Application: WB - LncRNA-HAGLR motivates triple negative breast cancer progression by regulation of WNT2 via sponging miR-335-3p.
Journal: Aging (Albany NY) | Authors: Liting Jin | Species: human | Application: WB - Refined Jianpi Huayu Jiedu Decoction Attenuates TAM-Induced Spasmolytic Polypeptide-Expressing Metaplasia (SPEM) by Modulating LCN2-Associated Mitochondrial Dysfunction.
Journal: Pharmaceuticals (Basel) | Authors: Chongkai Fang | Application: WB - Isaridin E Protects Against UVB-Induced Photoaging by Activating Wnt/β-Catenin Signaling Pathway and Alleviating Mitochondrial Dysfunction.
Journal: Mar Drugs | Authors: Yaosheng Liu | Species: mouse | Application: WB - Long non-coding RNA LINC01224 plays an oncogenic role in endometrial cancer via miR-4673/TPX2 axis and activating Wnt/β-catenin signaling pathway
Journal: Biofactors | Authors: Shuqing Lv | Species: human | Application: WB - miR-96-5p antagonizes FOXQ1-driven WNT/β-catenin signaling to inhibit triple-negative breast cancer.
Journal: Sci Rep | Authors: Zhuoran Zhang | Species: human | Application: WB - Highly expressed VGLL3 in keloid fibroblasts promotes glycolysis and collagen production via the activation of Wnt/β-catenin signaling
Journal: Cell Signal | Authors: Yining Liu | Species: human | Application: IHC - Excess folic acid supplementation before and during pregnancy and lactation activates β-catenin in the brain of male mouse offspring.
Journal: Brain Res Bull | Authors: Qian Wu | Species: mouse | Application: WB - Bisphenol A exposure alters placentation and causes preeclampsia-like features in pregnant mice involved in reprogramming of DNA methylation of WNT2.
Journal: FASEB J | Authors: Yunzhen Ye | Species: mouse | Application: WB - Comparative study on seasonal hair follicle cycling by analysis of the transcriptomes from cashmere and milk goats.
Journal: Genomics | Authors: Yanjun Zhang - Mycoplasma hyorhinis infection promotes gastric cancer cell motility via β-catenin signaling.
Journal: Cancer Med | Authors: Xia Liu | Species: human | Application: WB - Exosomal miR-320e through wnt2targeted inhibition of the Wnt/β-catenin pathway allevisate cerebral small vessel disease and cognitive impairment
Journal: World J Psychiatry | Authors: Zheng Wang | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
