WWC2 Polyclonal antibody 24750-1-AP proteintech
$149.00
In stock
SKU
24750-1-AP
| Catalog Number | 24750-1-AP |
| Synonyms | BH 3 only member B, BH-3-only member B, BOMB, Protein WWC2, WW and C2 domain containing 2 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue |
| Tested Applications — Positive IP detected in | HEK-293 cells |
| Tested Applications — Positive IHC detected in | human kidney tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HEK-293 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Positive WB detected in | mouse brain tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human kidney tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag20479 Product name: Recombinant human WWC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1080-1165 aa of BC017957 Sequence: QSRLNDELQALRDLRQKLEELKAQGETDLPPGVLEDERFQRLLKQAEKQAEQSKEEQKQGLNAEKLMRQVSKDVCRLREQSQKVPR Predict reactive species |
| Full Name | WW and C2 domain containing 2 |
| Calculated Molecular Weight | 1192 aa, 134 kDa |
| Observed Molecular Weight | 150 kDa |
| GenBank Accession Number | BC017957 |
| Gene Symbol | WWC2 |
| Gene ID (NCBI) | 80014 |
| RRID | AB_2879704 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6AWC2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for WWC2 antibody 24750-1-AP | Download protocol |
| IHC protocol for WWC2 antibody 24750-1-AP | Download protocol |
| IP protocol for WWC2 antibody 24750-1-AP | Download protocol |
| WB protocol for WWC2 antibody 24750-1-AP | Download protocol |
| human | WB Cell Signal An integrative pan-cancer analysis of WWC family genes and functional validation in lung cancer Authors - Hongmei Huang View Article |
| mouse | WB Cancer Immunol Res CLK1 Promotes Myeloid-Derived Suppressor Cell Trafficking and Reprograms the Tumor Microenvironment by Activating Hippo/YAP Signaling in Colorectal Cancer. Authors - Peisi Li KD Validated View Article |
| Citations | 3 |
| Dilutions | WB : 1:1000-1:6000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:200-1:800 IF/ICC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
WWC2 alson named as BOMB or WW and C2 domain containing 2 is 1192 amino acid protein, which contains 1 C2 domain and 2 WW domains. WWC2 localizes in cytoplasm and belongs to the WWC family. , WWC2 exists as seven alternatively spliced isoforms and is encoded by a gene located on human chromosome 4q35.1. WWC2 may be expressed in liver, brain, prostate and kidney. The function of WWC2 is still non-known and need to be further studied. Protocols Product Specific Protocols IF protocol for WWC2 antibody 24750-1-AP Download protocol IHC protocol for WWC2 antibody 24750-1-AP Download protocol IP protocol for WWC2 antibody 24750-1-AP Download protocol WB protocol for WWC2 antibody 24750-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- An integrative pan-cancer analysis of WWC family genes and functional validation in lung cancer
Journal: Cell Signal | Authors: Hongmei Huang | Species: human | Application: WB - TEAD1 regulates cell proliferation through a pocket-independent transcription repression mechanism
Journal: Nucleic Acids Res | Authors: Feng Li | Species: mouse | Application: WB - CLK1 Promotes Myeloid-Derived Suppressor Cell Trafficking and Reprograms the Tumor Microenvironment by Activating Hippo/YAP Signaling in Colorectal Cancer.
Journal: Cancer Immunol Res | Authors: Peisi Li KD Validated | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
