AMACR/p504S Polyclonal antibody 15918-1-AP proteintech
$149.00
In stock
SKU
15918-1-AP
| Catalog Number | 15918-1-AP |
| Synonyms | AMACR, p504S, EC:5.1.99.4, Alpha-methylacyl-CoA racemase, 2-methylacyl-CoA racemase |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, LNCaP cells, MCF-7 cells |
| Tested Applications — Positive IHC detected in | human prostate cancer tissue, human renal cell carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:5000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Positive WB detected in | HEK-293 cells, LNCaP cells, MCF-7 cells |
| Positive IHC detected in | human prostate cancer tissue, human renal cell carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8720 Product name: Recombinant human p504S,AMACR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC009471 Sequence: MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNS Predict reactive species |
| Full Name | alpha-methylacyl-CoA racemase |
| Calculated Molecular Weight | 382 aa, 42 kDa |
| Observed Molecular Weight | 44 kDa |
| GenBank Accession Number | BC009471 |
| Gene Symbol | AMACR |
| Gene ID (NCBI) | 23600 |
| RRID | AB_11126973 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UHK6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for AMACR/p504S antibody 15918-1-AP | Download protocol |
| WB protocol for AMACR/p504S antibody 15918-1-AP | Download protocol |
| human | WB,IF Commun Biol ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (ST3Gal1) synthesis of Siglec ligands mediates anti-tumour immunity in prostate cancer Authors - Rebecca Garnham View Article |
| Citations | 6 |
| Dilutions | WB : 1:1000-1:5000 IHC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
AMACR(Alpha-methyl acyl-CoA racemase) belongs to the CaiB/BaiF CoA-transferase family. It is a mitochondrial and peroxisomal enzyme that catalyzes the conversion of 2R stereoisomers of phytanic and pristanic acid to their S counterparts. AMACR has previously been shown to be a highly sensitive marker for colorectal and clinically localized prostate cancer (PCa). However, AMACR expression is down-regulated at the transcript and protein level in hormone-refractory metastatic PCa, suggesting a hormone-dependent expression of AMACR(PMID:12213712). It has 3 isoforms produced by alternative splicing and it can form a dimer of 70-75 kDa(PMID:21812041). Defects in AMACR are the cause of alpha-methyl acyl-CoA racemase deficiency (AMACRD) and congenital bile acid synthesis defect type 4 (CBAS4). Protocols Product Specific Protocols IHC protocol for AMACR/p504S antibody 15918-1-AP Download protocol WB protocol for AMACR/p504S antibody 15918-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer
Journal: Adv Sci (Weinh) | Authors: Rong Wang | Species: human | Application: WB - SMARCC1 Suppresses Tumor Progression by Inhibiting the PI3K/AKT Signaling Pathway in Prostate Cancer.
Journal: Front Cell Dev Biol | Authors: Zhao-Ming Xiao | Species: human | Application: IHC - The auxiliary diagnostic value of prostate-specific antigen and α-methylacyl-CoA racemase in prostate cancer.
Journal: Oncol Lett | Authors: Daijun Yang | Species: human | Application: IHC - Circ_0076305 facilitates prostate cancer development via sponging miR-411-5p and regulating PGK1.
Journal: Andrologia | Authors: Xiqi Ding | Species: human | Application: IHC - Targeting Siglec-engaging immunosuppressive sialoglycans to suppress prostate cancer bone metastasis.
Journal: Br J Cancer | Authors: Ziqian Peng - ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (ST3Gal1) synthesis of Siglec ligands mediates anti-tumour immunity in prostate cancer
Journal: Commun Biol | Authors: Rebecca Garnham | Species: human | Application: WB,IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
