AMACR/p504S Recombinant monoclonal antibody, PBS Only 84891-1-PBS proteintech
$699.00
In stock
SKU
84891-1-PBS
| Catalog Number | 84891-1-PBS |
| Synonyms | AMACR, p504S, 2-methylacyl-CoA racemase, Alpha-methylacyl-CoA racemase, EC:5.1.99.4 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag8720 Product name: Recombinant human p504S,AMACR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC009471 Sequence: MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNS Predict reactive species |
| Full Name | alpha-methylacyl-CoA racemase |
| Calculated Molecular Weight | 382 aa, 42 kDa |
| GenBank Accession Number | BC009471 |
| Gene Symbol | AMACR |
| Gene ID (NCBI) | 23600 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UHK6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242456C3 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
