ARHGDIB Polyclonal antibody 16122-1-AP proteintech
$149.00
In stock
SKU
16122-1-AP
| Catalog Number | 16122-1-AP |
| Synonyms | ARHGDIB, D4, GDIA2, GDID4, Ly GDI, LYGDI, RAP1GN1, Rho GDI 2, Rho GDI beta, RhoGDI2 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IP, ELISA |
| Applications | WB, IP, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HL-60 cells, K-562 cells, rat spleen tissue, Jurkat cells, Raji cells |
| Tested Applications — Positive IP detected in | Raji cells |
| Tested Applications — Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Positive WB detected in | HL-60 cells, K-562 cells, rat spleen tissue, Jurkat cells, Raji cells |
| Positive IP detected in | Raji cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag9078 Product name: Recombinant human ARHGDIB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC009200 Sequence: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE Predict reactive species |
| Full Name | Rho GDP dissociation inhibitor (GDI) beta |
| Calculated Molecular Weight | 201 aa, 23 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC009200 |
| Gene Symbol | ARHGDIB |
| Gene ID (NCBI) | 397 |
| RRID | AB_2059596 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P52566 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for ARHGDIB antibody 16122-1-AP | Download protocol |
| IP protocol for ARHGDIB antibody 16122-1-AP | Download protocol |
| WB protocol for ARHGDIB antibody 16122-1-AP | Download protocol |
| human | WB DNA Cell Biol Rho GDP Dissociation Inhibitor (GDI) Beta Promotes Cell Proliferation and Invasion by Modulating the AKT Pathway in Hepatocellular Carcinoma. Authors - Yang Fang View Article |
| Citations | 8 |
| Dilutions | WB : 1:5000-1:50000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
ARHGDIB, also known as RhoGDI2, is a conserved member of the RhoGDI family and plays an important role in cell migrations. It regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. It is mainly in hematopoietic, endothelial, and epithelial cells. It has been linked to tumorigenesis and metastasis. RhoGDI2 expression is downregulated in several cancer types, such as bladder, lung and lymphoma, but is upregulated in prostate and gastric cancer. Protocols Product Specific Protocols IHC protocol for ARHGDIB antibody 16122-1-AP Download protocol IP protocol for ARHGDIB antibody 16122-1-AP Download protocol WB protocol for ARHGDIB antibody 16122-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Enhanced BCAT1 activity and BCAA metabolism promotes RhoC activity in cancer progression
Journal: Nat Metab | Authors: Lin Qian | Species: human | Application: WB - Kinases Mst1 and Mst2 positively regulate phagocytic induction of reactive oxygen species and bactericidal activity.
Journal: Nat Immunol | Authors: Jing Geng | Species: human | Application: WB - KDM6A-ARHGDIB axis blocks metastasis of bladder cancer by inhibiting Rac1.
Journal: Mol Cancer | Authors: Lei Liu | Species: human | Application: WB - Changes in the proteomic profile during the differential polarization status of the human monocyte-derived macrophage THP-1 cell line.
Journal: Proteomics | Authors: Fan Zhang | Species: human | Application: WB - Systematic investigation of biomarker-like role of ARHGDIB in breast cancer.
Journal: Cancer Biomark | Authors: Xiaonan Wang KD Validated | Species: human | Application: WB,IHC - Rho GDP Dissociation Inhibitor (GDI) Beta Promotes Cell Proliferation and Invasion by Modulating the AKT Pathway in Hepatocellular Carcinoma.
Journal: DNA Cell Biol | Authors: Yang Fang | Species: human | Application: WB - Rho GDP Dissociation Inhibitor (GDI) Beta Promotes Cell Proliferation and Invasion by Modulating the AKT Pathway in Hepatocellular Carcinoma.
Journal: DNA Cell Biol | Authors: Yang Fang | Species: human | Application: WB - Systematic investigation of biomarker-like role of ARHGDIB in breast cancer.
Journal: Cancer Biomark | Authors: Xiaonan Wang | Species: human | Application: WB,IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
