HPRT Polyclonal antibody 15059-1-AP proteintech
$149.00
In stock
SKU
15059-1-AP
| Catalog Number | 15059-1-AP |
| Synonyms | HPRT1, EC:2.4.2.8, HGPRT, HGPRTase, Hypoxanthine-guanine phosphoribosyltransferase |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, FC (Intra), IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HEK-293 cells, A549 cells, mouse liver tissue, MCF-7 cells, HepG2 cells, Jurkat cells, Y79 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue |
| Tested Applications — Positive IP detected in | mouse brain tissue |
| Tested Applications — Positive IHC detected in | mouse brain tissue, human liver cancer tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Tested Applications — Positive FC (Intra) detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | HeLa cells, HEK-293 cells, A549 cells, mouse liver tissue, MCF-7 cells, HepG2 cells, Jurkat cells, Y79 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue, human liver cancer tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag7044 Product name: Recombinant human HPRT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-218 aa of BC000578 Sequence: MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA Predict reactive species |
| Full Name | hypoxanthine phosphoribosyltransferase 1 |
| Calculated Molecular Weight | 25 kDa |
| Observed Molecular Weight | 24-28 kDa |
| GenBank Accession Number | BC000578 |
| Gene Symbol | HPRT1 |
| Gene ID (NCBI) | 3251 |
| RRID | AB_10638622 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P00492 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for HPRT antibody 15059-1-AP | Download protocol |
| IF protocol for HPRT antibody 15059-1-AP | Download protocol |
| IHC protocol for HPRT antibody 15059-1-AP | Download protocol |
| IP protocol for HPRT antibody 15059-1-AP | Download protocol |
| WB protocol for HPRT antibody 15059-1-AP | Download protocol |
| human | WB EMBO Rep MYC promotes cancer progression by modulating m6 A modifications to suppress target gene translation. Authors - Gongwei Wu View Article |
| rat | WB J Clin Invest ZFP36L2 suppresses mTORc1 through a P53-dependent pathway to prevent peri-partum cardiomyopathy in mice. Authors - Hidemichi Kouzu View Article |
| mouse,human | WB Br J Cancer Blocking of oestrogen signals improves anti-tumour effect regardless of oestrogen receptor alpha expression in cancer cells Authors - Nabeel Kajihara View Article |
| mouse | WB Elife Aging is associated with increased brain iron through cortex-derived hepcidin expression. Authors - Tatsuya Sato View Article |
| Andrea (Verified Customer) (07-24-2026) | It works properly by WB on cerebellar lysates (20ug of proteins loaded) Applications: Western Blot Primary Antibody Dilution: 1:5000 Cell Tissue Type: Cerebellum |
| Citations | 46 |
| Dilutions | WB : 1:2000-1:10000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:200-1:800 IF/ICC : 1:200-1:800 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
HPRT, also named HPRT1 and HGPRT, plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutation of HPRT1 is associated with Lesch-Nyhan syndrome (LNS) which is an X-linked inherited neurogenetic disorder of purine metabolism. It has been reported that HPRT1 also plays an important role in HPRT-related gout. Protocols Product Specific Protocols FC protocol for HPRT antibody 15059-1-AP Download protocol IF protocol for HPRT antibody 15059-1-AP Download protocol IHC protocol for HPRT antibody 15059-1-AP Download protocol IP protocol for HPRT antibody 15059-1-AP Download protocol WB protocol for HPRT antibody 15059-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Sirtuin 2 regulates cellular iron homeostasis via deacetylation of transcription factor NRF2.
Journal: J Clin Invest | Authors: Xiaoyan Yang | Species: human | Application: WB - ZFP36L2 suppresses mTORc1 through a P53-dependent pathway to prevent peri-partum cardiomyopathy in mice.
Journal: J Clin Invest | Authors: Hidemichi Kouzu | Species: rat | Application: WB - Blocking of oestrogen signals improves anti-tumour effect regardless of oestrogen receptor alpha expression in cancer cells
Journal: Br J Cancer | Authors: Nabeel Kajihara | Species: mouse,human | Application: WB - Mitochondrial dynamics define muscle fiber type by modulating cellular metabolic pathways
Journal: Cell Rep | Authors: Tatsuki Yasuda | Species: mouse | Application: WB - MYC promotes cancer progression by modulating m6 A modifications to suppress target gene translation.
Journal: EMBO Rep | Authors: Gongwei Wu | Species: human | Application: WB - Aging is associated with increased brain iron through cortex-derived hepcidin expression.
Journal: Elife | Authors: Tatsuya Sato | Species: mouse | Application: WB - Accumulation of succinate suppresses de novo purine synthesis through succinylation-mediated control of the mitochondrial folate cycle.
Journal: Mol Cell | Authors: Mushtaq A. Nengroo - ZFP36L2 suppresses mTORc1 through a P53-dependent pathway to prevent peri-partum cardiomyopathy in mice.
Journal: J Clin Invest | Authors: Hidemichi Kouzu | Species: rat | Application: WB - Sirtuin 2 regulates cellular iron homeostasis via deacetylation of transcription factor NRF2.
Journal: J Clin Invest | Authors: Xiaoyan Yang | Species: human | Application: WB - Arginine limitation drives a directed codon-dependent DNA sequence evolution response in colorectal cancer cells
Journal: Sci Adv | Authors: Dennis J Hsu | Species: human | Application: WB - Differential expression of interferon-γ and chemokine genes distinguishes Rasmussen encephalitis from cortical dysplasia and provides evidence for an early Th1 immune response.
Journal: J Neuroinflammation | Authors: Owens Geoffrey C GC | Species: human | Application: WB - Metabolomic and transcriptomic profiling of HNSCC identifies AMIGO2 as a therapeutic target modulating tumor microenvironment.
Journal: NPJ Precis Oncol | Authors: Gan Liu | Species: human | Application: IHC - Blocking of oestrogen signals improves anti-tumour effect regardless of oestrogen receptor alpha expression in cancer cells
Journal: Br J Cancer | Authors: Nabeel Kajihara | Species: mouse,human | Application: WB - IMPDH2 dephosphorylation under FGFR signaling promotes S-phase progression and tumor growth
Journal: Cell Rep | Authors: Bei Zhou - Mitochondrial dynamics define muscle fiber type by modulating cellular metabolic pathways
Journal: Cell Rep | Authors: Tatsuki Yasuda | Species: mouse | Application: WB - Disrupted mitochondrial dynamics activate RNA-sensing innate immunity through mitochondrial RNA release.
Journal: Cell Rep | Authors: Tatsuki Yasuda - Neurobehavioral deficits of mice expressing a low level of G127V mutant frataxin
Journal: Neurobiol Dis | Authors: Daniel Fil | Species: mouse | Application: WB - MYC promotes cancer progression by modulating m6 A modifications to suppress target gene translation.
Journal: EMBO Rep | Authors: Gongwei Wu | Species: human | Application: WB - Identification of Exosome-Related Genes Associated with Prognosis and Immune Infiltration Features in Head-Neck Squamous Cell Carcinoma
Journal: Biomolecules | Authors: Yuanhe You | Species: human | Application: IHC - Exploring Exosome Contributions to Gouty Arthritis: A Proteomics and Experimental Study.
Journal: Int J Mol Sci | Authors: Chengjin Lu | Species: rat | Application: WB - Design and validation of cell-based potency assays for frataxin supplementation treatments
Journal: Mol Ther Methods Clin Dev | Authors: Shibani Mukherjee | Species: mouse | Application: WB - Generation of Hprt-disrupted rat through mouse←rat ES chimeras.
Journal: Sci Rep | Authors: Ayako Isotani | Species: mouse | Application: WB - Genome-wide CRISPR/Cas9-knockout in human induced Pluripotent Stem Cell (iPSC)-derived macrophages.
Journal: Sci Rep | Authors: Elena Navarro-Guerrero | Species: human | Application: WB - Integrative multi-omics analysis reveals metabolic dysfunction signatures as critical determinants of prostate cancer prognosis and immunosuppressive microenvironments.
Journal: Eur J Med Res | Authors: Xiangqian Nie | Species: human | Application: WB - Short-term Low-Dose mTORC1 Inhibition in Aged Rats Counter-Regulates Age-Related Gene Changes and Blocks Age-Related Kidney Pathology.
Journal: J Gerontol A Biol Sci Med Sci | Authors: Tea Shavlakadze | Species: human | Application: WB - Prenatal Exposure to a Maternal High Fat Diet Increases Hepatic Cholesterol Accumulation in Intrauterine Growth Restricted Rats in Part Through MicroRNA-122 Inhibition of Cyp7a1.
Journal: Front Physiol | Authors: Erin K Zinkhan | Species: human | Application: WB - Significance and Amplification Methods of the Purine Salvage Pathway in Human Brain Cells
Journal: J Biol Chem | Authors: Mai Sekine | Species: human | Application: WB - Intrauterine growth restriction influences vascular remodeling and stiffening in the weanling rat more than sex or diet
Journal: Am J Physiol Heart Circ Physiol | Authors: R Blair Dodson | Species: rat | Application: WB - The Impact of Diet on the Persistence of Early Vascular Remodeling and Stiffening Induced by Intrauterine Growth Restriction and a Maternal High-fat Diet.
Journal: Am J Physiol Heart Circ Physiol | Authors: Thomas A Miller - Mitochondrial damage and senescence phenotype of cells derived from a novel frataxin G127V point mutation mouse model of Friedreich's ataxia.
Journal: Dis Model Mech | Authors: Daniel Fil | Species: mouse | Application: WB - HPRT promotes proliferation and metastasis in head and neck squamous cell carcinoma through direct interaction with STAT3.
Journal: Exp Cell Res | Authors: Lin Wang | Species: human | Application: IF - New allele of mouse DNA/RNA helicase senataxin causes meiotic arrest and infertility
Journal: Reproduction | Authors: Yasuhiro Fujiwara | Species: mouse | Application: WB - Deciphering the Role of N-Acetyltransferase 10 in Thalamic Hemorrhage Through Integrative Multi-Omics and Experimental Validation.
Journal: J Integr Neurosci | Authors: Yaqun Li | Species: mouse | Application: WB,IHC - Combination of intrauterine growth restriction and a high-fat diet impairs cholesterol elimination in rats.
Journal: Pediatr Res | Authors: Erin K Zinkhan | Species: rat | Application: WB - A delayed sperm penetration of cumulus layers by disruption of acrosin gene in rats.
Journal: Biol Reprod | Authors: Ayako Isotani | Species: rat | Application: WB - Guanosine primes acute myeloid leukemia for differentiation via guanine nucleotide salvage synthesis.
Journal: Am J Cancer Res | Authors: Hanying Wang | Species: human | Application: WB - Uteroplacental Insufficiency Impairs Cholesterol Elimination in Adult Female Growth-Restricted Rat Offspring Fed a High-Fat Diet.
Journal: Reprod Sci | Authors: Erin K Zinkhan | Species: rat | Application: WB - Spatiotemporal Regulation of De Novo and Salvage Purine Synthesis during Brain Development
Journal: eNeuro | Authors: Tomoya Mizukoshi | Species: mouse | Application: WB,IF - The TGF-β1 target WISP1 is highly expressed in liver cirrhosis and cirrhotic HCC microenvironment and involved in pro- and anti-tumorigenic effects
Journal: Biochem Biophys Res Commun | Authors: Anne Dropmann | Species: mouse | Application: WB - Intrauterine growth restriction combined with a maternal high-fat diet increases hepatic cholesterol and low-density lipoprotein receptor activity in rats.
Journal: Physiol Rep | Authors: Erin K Zinkhan | Species: rat | Application: WB - Large artery stiffening and mortality in a rat model of early vascular remodeling induced by intrauterine growth restriction and a high‐fat diet
Journal: Physiol Rep | Authors: Anastasiya Mankouski | Species: rat | Application: WB - Intrauterine growth restriction combined with a maternal high-fat diet increased adiposity and serum corticosterone levels in adult rat offspring.
Journal: J Dev Orig Health Dis | Authors: E K Zinkhan | Species: rat | Application: WB - CRISPR/Cas9-mediated generation of human embryonic stem cell sub-lines with HPRT1 gene knockout to model Lesch Nyhan disease
Journal: Stem Cell Res | Authors: Claire Boissart | Species: human | Application: WB - Aging is associated with increased brain iron through cortex-derived hepcidin expression.
Journal: Elife | Authors: Tatsuya Sato | Species: mouse | Application: WB - SIRT2 inhibition protects against cardiac hypertrophy and ischemic injury
Journal: Elife | Authors: Xiaoyan Yang | Species: rat | Application: WB - SIRT2 inhibition protects against cardiac hypertrophy and heart failure
Journal: bioRxiv | Authors: Xiaoyan Yang | Species: mouse,human | Application: WB - Impact of Renal Iron Overload on Sickle Cell Nephropathy in a Humanized Mouse Model.
Journal: Am J Physiol Renal Physiol | Authors: Mohammad O. Sako | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
