BRD2 Polyclonal antibody 22236-1-AP proteintech
$149.00
In stock
SKU
22236-1-AP
| Catalog Number | 22236-1-AP |
| Synonyms | bromodomain containing 2, Bromodomain-containing protein 2, D6S113E, FSH, FSRG1 |
| Host | Rabbit |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ChIP, ELISA |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, J774A. 1 cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:16000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Positive WB detected in | HeLa cells, J774A. 1 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag17589 Product name: Recombinant human BRD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 537-668 aa of BC063840 Sequence: LSQGPISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAALGPSGFGPSGGSGTKLQAGVQWRDLGLLQPPLLGFKRFSCLSLPSSQDYRLPKKATKTAPPALPTGYDS Predict reactive species |
| Full Name | bromodomain containing 2 |
| Calculated Molecular Weight | 836 aa, 92 kDa |
| Observed Molecular Weight | 100-110 kDa |
| GenBank Accession Number | BC063840 |
| Gene Symbol | BRD2 |
| Gene ID (NCBI) | 6046 |
| RRID | AB_2722524 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P25440 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for BRD2 antibody 22236-1-AP | Download protocol |
| IHC protocol for BRD2 antibody 22236-1-AP | Download protocol |
| IP protocol for BRD2 antibody 22236-1-AP | Download protocol |
| WB protocol for BRD2 antibody 22236-1-AP | Download protocol |
| human | WB,IF Cell Mol Life Sci Histone demethylase KDM9 activates the CCND1/AKT pathway to promote the malignant progression of gliomas through interaction with BRD2 Authors - Jin Cheng View Article |
| mouse | WB J Neuroinflammation The BET PROTAC inhibitor dBET6 protects against retinal degeneration and inhibits the cGAS-STING in response to light damage Authors - Xingfei Zhu View Article |
| Citations | 16 |
| Dilutions | WB : 1:2000-1:16000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:500-1:2000 IF/ICC : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Prostate cancer-associated SPOP mutations confer resistance to BET inhibitors through stabilization of BRD4.
Journal: Nat Med | Authors: Xiangpeng Dai | Species: human | Application: WB - The H2A.Z and NuRD associated protein HMG20A controls early head and heart developmental transcription programs
Journal: Nat Commun | Authors: Andreas Herchenröther | Species: human | Application: WB - A di-acetyl-decorated chromatin signature couples liquid condensation to suppress DNA end synapsis
Journal: Mol Cell | Authors: Kaiwen Bao - Stromal induction of BRD4 phosphorylation Results in Chromatin Remodeling and BET inhibitor Resistance in Colorectal Cancer.
Journal: Nat Commun | Authors: Wenyu Wang | Species: human | Application: WB - The BET PROTAC inhibitor dBET6 protects against retinal degeneration and inhibits the cGAS-STING in response to light damage
Journal: J Neuroinflammation | Authors: Xingfei Zhu | Species: mouse | Application: WB - Histone demethylase KDM9 activates the CCND1/AKT pathway to promote the malignant progression of gliomas through interaction with BRD2
Journal: Cell Mol Life Sci | Authors: Jin Cheng | Species: human | Application: WB,IF - BET protein-dependent E2F pathway activity confers bell-shaped type resistance to tankyrase inhibitors in APC-mutated colorectal cancer
Journal: Cancer Lett | Authors: Shun Morino | Species: human | Application: WB - The BET PROTAC inhibitor dBET6 protects against retinal degeneration and inhibits the cGAS-STING in response to light damage
Journal: J Neuroinflammation | Authors: Xingfei Zhu | Species: mouse | Application: WB - Design of PROTACs utilizing the E3 ligase GID4 for targeted protein degradation
Journal: Nat Struct Mol Biol | Authors: Yanran Li | Species: human | Application: WB - Mitochondrial control of proteasomal Psmb5 drives the differentiation of tissue-resident memory T cells in patients with rheumatoid arthritis
Journal: Arthritis Rheumatol | Authors: Tong Wu | Species: human | Application: WB,IP,ChIP - Discovery of the First BRD4 Second Bromodomain (BD2)-Selective Inhibitors
Journal: J Med Chem | Authors: Junhua Li | Species: human | Application: WB - Histone demethylase KDM9 activates the CCND1/AKT pathway to promote the malignant progression of gliomas through interaction with BRD2
Journal: Cell Mol Life Sci | Authors: Jin Cheng | Species: human | Application: WB,IF - Apabetalone alleviates ligature-induced periodontitis by inhibiting M1 macrophage polarization via an immunometabolic shift
Journal: Int Immunopharmacol | Authors: Tianying Bian | Species: mouse | Application: WB - BRD4-mediated transcriptional activation of PDLIM4 enhances p21 stability and chemosensitivity in lung adenocarcinoma independent of p53.
Journal: BMC Biol | Authors: Qingwei Wang | Species: human | Application: WB - The BET degrader BETd-246 demonstrated significant anti-tumor efficacy in T-cell acute lymphoblastic leukemia by inhibiting TRAT1.
Journal: Exp Cell Res | Authors: Haixia Ge | Species: human | Application: WB - The MYC Paralog-PARP1 Axis as a Potential Therapeutic Target in MYC Paralog-Activated Small Cell Lung Cancer.
Journal: Front Oncol | Authors: Xing Bian | Species: human | Application: WB - Targeted BRD4 degradation by multivalent dendrimer-based PROTAC and its combined effects with chemotherapy on colon cancer.
Journal: Biomaterials | Authors: Ramalingam Sharmila | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
