CNN2 Polyclonal antibody 21073-1-AP proteintech
$149.00
In stock
SKU
21073-1-AP
| Catalog Number | 21073-1-AP |
| Synonyms | calponin 2, Calponin H2, smooth muscle, CNN2, Neutral calponin |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HepG2 cells |
| Tested Applications — Positive IHC detected in | human heart tissue, human hysteromyoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | HeLa cells, HepG2 cells |
| Positive IHC detected in | human heart tissue, human hysteromyoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag15225 Product name: Recombinant human CNN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 224-309 aa of BC141818 Sequence: PGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY Predict reactive species |
| Full Name | calponin 2 |
| Calculated Molecular Weight | 309 aa, 34 kDa |
| Observed Molecular Weight | 34-36 kDa |
| GenBank Accession Number | BC141818 |
| Gene Symbol | CNN2 |
| Gene ID (NCBI) | 1265 |
| RRID | AB_10695503 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99439 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CNN2 antibody 21073-1-AP | Download protocol |
| IHC protocol for CNN2 antibody 21073-1-AP | Download protocol |
| WB protocol for CNN2 antibody 21073-1-AP | Download protocol |
| mouse | IF Circ Res Mitochondrial Protein Poldip2 Controls VSMC Differentiated Phenotype by O-Linked GlcNAc Transferase-Dependent Inhibition of a Ubiquitin Proteasome System. Authors - Felipe Paredes View Article |
| human | WB Curr Biol Calponin isoforms define the cell-type-specific organization and dynamics of actomyosin bundles. Authors - Shrikant B. Kokate KO Validated View Article |
| rat | WB Front Pharmacol Activation of the Cholinergic Anti-inflammatory Pathway Attenuated Angiotension II-Dependent Hypertension and Renal Injury. Authors - Shu-Jie Wu View Article |
| Citations | 11 |
| Dilutions | WB : 1:2000-1:10000 IHC : 1:20-1:200 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). Calponin 1 and calponin 2 are predominately expressed in smooth muscle cells and cardiac muscle cells, respectively. Calponin 3 is highly expressed in many tissues including articular cartilage and brain. Protocols Product Specific Protocols IF protocol for CNN2 antibody 21073-1-AP Download protocol IHC protocol for CNN2 antibody 21073-1-AP Download protocol WB protocol for CNN2 antibody 21073-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Mitochondrial Protein Poldip2 Controls VSMC Differentiated Phenotype by O-Linked GlcNAc Transferase-Dependent Inhibition of a Ubiquitin Proteasome System.
Journal: Circ Res | Authors: Felipe Paredes | Species: mouse | Application: IF - Inhibitor of Differentiation 4 (ID4) represses mammary myoepithelial differentiation via inhibition of HEB.
Journal: iScience | Authors: Holly Holliday | Species: human | Application: IHC, WB - Activation of the Cholinergic Anti-inflammatory Pathway Attenuated Angiotension II-Dependent Hypertension and Renal Injury.
Journal: Front Pharmacol | Authors: Shu-Jie Wu | Species: rat | Application: WB - Knockdown of calponin 2 suppressed cell growth in gastric cancer cells.
Journal: Tumour Biol | Authors: Jianwei Hu KD Validated | Species: human | Application: WB - H2-calponin attenuate metastasis in human NSCLC by suppressing RSK2 expression
Journal: Pathol Res Pract | Authors: Yu Guo - Calponin isoforms define the cell-type-specific organization and dynamics of actomyosin bundles.
Journal: Curr Biol | Authors: Shrikant B. Kokate KO Validated | Species: human | Application: WB - Inhibitor of Differentiation 4 (ID4) represses mammary myoepithelial differentiation via inhibition of HEB.
Journal: iScience | Authors: Holly Holliday | Species: human | Application: IHC, WB - H2-calponin attenuate metastasis in human NSCLC by suppressing RSK2 expression
Journal: Pathol Res Pract | Authors: Yu Guo - Knockdown of calponin 2 suppressed cell growth in gastric cancer cells.
Journal: Tumour Biol | Authors: Jianwei Hu | Species: human | Application: WB - Galactomyces ferment filtrate upregulates anchoring junctions and stabilizes actin to maintain the Young's modulus of skin cells in vitro
Journal: Int J Cosmet Sci | Authors: Steph Crabtree | Application: IF - Differential regulation of hair cell actin cytoskeleton mediated by SRF and MRTFB
Journal: Elife | Authors: Ling-Yun Zhou | Species: mouse | Application: IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
