CXCR2 Recombinant monoclonal antibody 85144-5-RR proteintech
$149.00
In stock
SKU
85144-5-RR
| Catalog Number | 85144-5-RR |
| Synonyms | 242766H6, CD182, Cmkar2, C-X-C chemokine receptor type 2, CXC-R2 |
| Host | Rabbit |
| Reactivity | mouse, rat and More (1) |
| Reactivity | mouse, rat, human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | rat liver tissue |
| Tested Applications — Positive IHC detected in | rat spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Positive WB detected in | rat liver tissue |
| Positive IHC detected in | rat spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Tested Reactivity | mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2228 Product name: Recombinant Mouse CXCR2 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-47 aa of NM_009909.3 Sequence: MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLEINS Predict reactive species |
| Full Name | interleukin 8 receptor, beta |
| Calculated Molecular Weight | 40 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | NM_009909.3 |
| Gene Symbol | Cxcr2 |
| Gene ID (NCBI) | 12765 |
| RRID | AB_3744051 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P35343 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for CXCR2 antibody 85144-5-RR | Download protocol |
| WB protocol for CXCR2 antibody 85144-5-RR | Download protocol |
| mouse | WB ACS Nano Charge-Adaptive Nanoparticle Attenuates Inflammation via Targeting Neutrophil Extracellular Traps (NETs) and Breaking NETs-Macrophage Crosstalk. Authors - Yang Chen View Article |
| human | WB Adv Sci (Weinh) Transcription Factor HOXC11 Drives Colorectal Cancer Progression and Metastasis via CAMK2A-Dependent CXCL5 Upregulation Authors - Qingyang Sun View Article |
| Citations | 2 |
| Dilutions | WB : 1:1000-1:4000 IHC : 1:250-1:1000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242766H6 |
| Conjugation | Unconjugated |
CXCR2, also named as Cmkar2, Gpcr16, Il8rb or CD182, belongs to the G-protein coupled receptor 1 family. CXCR2 is a receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. CXCR2 binds to IL-8 with high affinity. CXCR2 also binds with high affinity to CXCL3, GRO/MGSA and NAP-2. Protocols Product Specific Protocols IHC protocol for CXCR2 antibody 85144-5-RR Download protocol WB protocol for CXCR2 antibody 85144-5-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Charge-Adaptive Nanoparticle Attenuates Inflammation via Targeting Neutrophil Extracellular Traps (NETs) and Breaking NETs-Macrophage Crosstalk.
Journal: ACS Nano | Authors: Yang Chen | Species: mouse | Application: WB - Transcription Factor HOXC11 Drives Colorectal Cancer Progression and Metastasis via CAMK2A-Dependent CXCL5 Upregulation
Journal: Adv Sci (Weinh) | Authors: Qingyang Sun | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
