SLC10A1 Monoclonal antibody, PBS Only (Capture) 60876-1-PBS proteintech
$699.00
In stock
SKU
60876-1-PBS
| Catalog Number | 60876-1-PBS |
| Synonyms | NTCP, 1A8C10 |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag25680 Product name: Recombinant human SLC10A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 136-219 aa of BC074724 Sequence: LLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMT Predict reactive species |
| Full Name | solute carrier family 10 (sodium/bile acid cotransporter family), member 1 |
| Calculated Molecular Weight | 349 aa, 38 kDa |
| GenBank Accession Number | BC074724 |
| Gene Symbol | SLC10A1 |
| Gene ID (NCBI) | 6554 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q14973 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1A8C10 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
