ATOX1 Recombinant monoclonal antibody, PBS Only (Detector) 83785-5-PBS proteintech
$699.00
In stock
SKU
83785-5-PBS
| Catalog Number | 83785-5-PBS |
| Synonyms | Antioxidant 1, ATOX 1, ATX1 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag18460 Product name: Recombinant human ATOX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC112248 Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE Predict reactive species |
| Full Name | ATX1 antioxidant protein 1 homolog (yeast) |
| Calculated Molecular Weight | 68 aa, 8 kDa |
| GenBank Accession Number | BC112248 |
| Gene Symbol | ATOX1 |
| Gene ID (NCBI) | 475 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O00244 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240679C1 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
